Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRIM32 polyclonal antibody (A01)

  • Catalog # : H00022954-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TRIM32.
  • Immunogen:
  • TRIM32 (NP_036342, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00022954-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TRIM32
  • Gene Alias:
  • BBS11,HT2A,LGMD2H,TATIP
  • Gene Description:
  • tripartite motif-containing 32
  • Gene Summary:
  • The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. [provided by RefSeq
  • Other Designations:
  • Limb-girdle muscular dystrophy 2H,OTTHUMP00000022763,TAT-interactive protein, 72-KD,limb girdle muscular dystrophy 2H (autosomal recessive),muscular dystrophy, Hutterite type,tripartite motif protein TRIM32,zinc-finger protein HT2A
  • RSS
  • YouTube
  • Linkedin
  • Facebook