P2RX2 monoclonal antibody (M02), clone 3D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
P2RX2 monoclonal antibody (M02), clone 3D5. Western Blot analysis of P2RX2 expression in MCF-7.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged P2RX2 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.32 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant P2RX2.
Immunogen
P2RX2 (NP_036358.2, 128 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPAS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.32 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
P2RX2 monoclonal antibody (M02), clone 3D5. Western Blot analysis of P2RX2 expression in MCF-7.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged P2RX2 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — P2RX2
Entrez GeneID
22953GeneBank Accession#
NM_012226Protein Accession#
NP_036358.2Gene Name
P2RX2
Gene Alias
MGC129601, P2X2
Gene Description
purinergic receptor P2X, ligand-gated ion channel, 2
Omim ID
600844Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
ATP receptor|P2X Receptor, subunit 2|P2X purinoceptor 2|purinergic receptor P2X2
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com