Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LTB4DH polyclonal antibody (A01)

  • Catalog # : H00022949-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LTB4DH.
  • Immunogen:
  • LTB4DH (NP_036344, 230 a.a. ~ 328 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00022949-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • LTB4DH polyclonal antibody (A01), Lot # 051212JC01 Western Blot analysis of LTB4DH expression in 293 ( Cat # L026V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PTGR1
  • Gene Alias:
  • LTB4DH,MGC34943,ZADH3
  • Gene Description:
  • prostaglandin reductase 1
  • Gene Summary:
  • This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is found on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • NADP-dependent leukotriene B4 12-hydroxydehydrogenase,OTTHUMP00000021915,leukotriene B4 12-hydroxydehydrogenase,zinc binding alcohol dehydrogenase domain containing 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook