DKK1 monoclonal antibody (M08), clone 2B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DKK1 monoclonal antibody (M08), clone 2B12 Western Blot analysis of DKK1 expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DKK1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of DKK1 transfected lysate using anti-DKK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DKK1 MaxPab rabbit polyclonal antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant DKK1.
Immunogen
DKK1 (AAH01539.1, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DKK1 monoclonal antibody (M08), clone 2B12 Western Blot analysis of DKK1 expression in HeLa ( Cat # L013V1 ).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DKK1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of DKK1 transfected lysate using anti-DKK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DKK1 MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — DKK1
Entrez GeneID
22943GeneBank Accession#
BC001539Protein Accession#
AAH01539.1Gene Name
DKK1
Gene Alias
DKK-1, SK
Gene Description
dickkopf homolog 1 (Xenopus laevis)
Omim ID
605189Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. [provided by RefSeq
Other Designations
OTTHUMP00000019617|dickkopf homolog 1|dickkopf related protein-1|dickkopf-1 like
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
High dickkopf-1 levels in sera and leukocytes from children with 21-hydroxylase deficiency on chronic glucocorticoid treatment.
Brunetti G, Faienza MF, Piacente L, Ventura A, Oranger A, Carbone C, Benedetto AD, Colaianni G, Gigante M, Mori G, Gesualdo L, Colucci S, Cavallo L, Grano M.
American Journal of Physiology - Endocrinology and Metabolism 2013 Mar; 304(5):E546.
Application：FlowCyt, Human, Serum.
-
High dickkopf-1 levels in sera and leukocytes from children with 21-hydroxylase deficiency on chronic glucocorticoid treatment.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com