DKK1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DKK1 expression in transfected 293T cell line (H00022943-T02) by DKK1 MaxPab polyclonal antibody.
Lane 1: DKK1 transfected lysate(28.70 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between DKK1 and CTNNB1. HeLa cells were stained with anti-DKK1 rabbit purified polyclonal 1:1200 and anti-CTNNB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human DKK1 protein.
Immunogen
DKK1 (NP_036374.1, 1 a.a. ~ 266 a.a) full-length human protein.
Sequence
MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DKK1 expression in transfected 293T cell line (H00022943-T02) by DKK1 MaxPab polyclonal antibody.
Lane 1: DKK1 transfected lysate(28.70 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between DKK1 and CTNNB1. HeLa cells were stained with anti-DKK1 rabbit purified polyclonal 1:1200 and anti-CTNNB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — DKK1
Entrez GeneID
22943GeneBank Accession#
NM_012242Protein Accession#
NP_036374.1Gene Name
DKK1
Gene Alias
DKK-1, SK
Gene Description
dickkopf homolog 1 (Xenopus laevis)
Omim ID
605189Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. [provided by RefSeq
Other Designations
OTTHUMP00000019617|dickkopf homolog 1|dickkopf related protein-1|dickkopf-1 like
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com