RPIA purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RPIA MaxPab polyclonal antibody. Western Blot analysis of RPIA expression in human spleen.
Western Blot (Tissue lysate)
RPIA MaxPab polyclonal antibody. Western Blot analysis of RPIA expression in human ovarian cancer.
Western Blot (Cell lysate)
RPIA MaxPab polyclonal antibody. Western Blot analysis of RPIA expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of RPIA expression in transfected 293T cell line (H00022934-T01) by RPIA MaxPab polyclonal antibody.
Lane 1: RPIA transfected lysate(26.18 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RPIA protein.
Immunogen
RPIA (AAH15529, 1 a.a. ~ 237 a.a) full-length human protein.
Sequence
MSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQDGSVNMREKPFC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RPIA MaxPab polyclonal antibody. Western Blot analysis of RPIA expression in human spleen.Western Blot (Tissue lysate)
RPIA MaxPab polyclonal antibody. Western Blot analysis of RPIA expression in human ovarian cancer.Western Blot (Cell lysate)
RPIA MaxPab polyclonal antibody. Western Blot analysis of RPIA expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of RPIA expression in transfected 293T cell line (H00022934-T01) by RPIA MaxPab polyclonal antibody.
Lane 1: RPIA transfected lysate(26.18 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RPIA
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com