SIRT2 monoclonal antibody (M01), clone 4B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SIRT2 expression in transfected 293T cell line by SIRT2 monoclonal antibody (M01), clone 4B11.
Lane 1: SIRT2 transfected lysate(39.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIRT2 is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of SIRT2 over-expressed 293 cell line, cotransfected with SIRT2 Validated Chimera RNAi ( Cat # H00022933-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SIRT2 monoclonal antibody (M01), clone 4B11 (Cat # H00022933-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SIRT2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SIRT2.
Immunogen
SIRT2 (AAH03012, 128 a.a. ~ 227 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (87)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SIRT2 expression in transfected 293T cell line by SIRT2 monoclonal antibody (M01), clone 4B11.
Lane 1: SIRT2 transfected lysate(39.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIRT2 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of SIRT2 over-expressed 293 cell line, cotransfected with SIRT2 Validated Chimera RNAi ( Cat # H00022933-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SIRT2 monoclonal antibody (M01), clone 4B11 (Cat # H00022933-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to SIRT2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SIRT2
Entrez GeneID
22933GeneBank Accession#
BC003012Protein Accession#
AAH03012Gene Name
SIRT2
Gene Alias
SIR2, SIR2L, SIR2L2
Gene Description
sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae)
Omim ID
604480Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two transcript variants result from alternative splicing of this gene. [provided by RefSeq
Other Designations
silencing information regulator 2-like|silent information regulator 2|sir2-related protein type 2|sirtuin 2|sirtuin type 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com