POMZP3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human POMZP3 full-length ORF (NP_036362.2, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTVEEEDQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDLFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGPADICQCCNKGDCGTPSHSRRQPRVVSQWSTSASRNRRHVTEEADVTVGATDLPGQEW
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
49.5
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — POMZP3
Entrez GeneID
22932GeneBank Accession#
NM_012230.2Protein Accession#
NP_036362.2Gene Name
POMZP3
Gene Alias
MGC8359, POM-ZP3, POM121
Gene Description
POM (POM121 homolog, rat) and ZP3 fusion
Omim ID
600587Gene Ontology
HyperlinkGene Summary
This gene appears to have resulted from a fusion of DNA sequences derived from 2 distinct loci, specifically through the duplication of two internal exons from the POM121 gene and four 3' exons from the ZP3 gene. The 5' end of this gene is similar to the 5` coding region of the POM121 gene which encodes an integral nuclear pore membrane protein. However, the protein encoded by this gene lacks the nuclear pore localization motif. The 3' end of this gene is similar to the last 4 exons of the zona pellucida glycoprotein 3 (ZP3) gene and the encoded protein retains one zona pellucida domain. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq
Other Designations
POM (POM121 rat homolog) and ZP3 fusion|POM-ZP3 fusion protein|POM121/ZP3 fusion protein|POMZP3 fusion protein
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com