Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATF6 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00022926-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ATF6 protein.
  • Immunogen:
  • ATF6 (AAH14969.1, 1 a.a. ~ 202 a.a) full-length human protein.
  • Sequence:
  • MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTISSIPPQT
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of ATF6 transfected lysate using anti-ATF6 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ATF6 purified MaxPab mouse polyclonal antibody (B01P) (H00022926-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Gene Name:
  • ATF6
  • Gene Alias:
  • ATF6A
  • Gene Description:
  • activating transcription factor 6
  • Gene Summary:
  • ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000025585,activating transcription factor 6 alpha
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook