MAPRE1 monoclonal antibody (M02), clone 4F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAPRE1 is 0.3 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAPRE1.
Immunogen
MAPRE1 (NP_036457, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAPRE1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — MAPRE1
Entrez GeneID
22919GeneBank Accession#
NM_012325Protein Accession#
NP_036457Gene Name
MAPRE1
Gene Alias
EB1, MGC117374, MGC129946
Gene Description
microtubule-associated protein, RP/EB family, member 1
Omim ID
603108Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family. [provided by RefSeq
Other Designations
OTTHUMP00000030608|adenomatous polyposis coli-binding protein EB1
-
Interactome
-
Publication Reference
-
Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol.
da Costa AN, Mijal RS, Keen JN, Findlay JB, Wild CP.
Proteomics 2011 May; 11(10):1903.
Application：Flow Cyt, Human, RPMI 1788, Jurkat E6.1 cells.
-
Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com