CD93 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CD93 partial ORF ( NP_036204, 33 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.62
Interspecies Antigen Sequence
Mouse (68); Rat (88)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CD93
Entrez GeneID
22918GeneBank Accession#
NM_012072Protein Accession#
NP_036204Gene Name
CD93
Gene Alias
C1QR1, C1qR(P), C1qRP, CDw93, MXRA4, dJ737E23.1
Gene Description
CD93 molecule
Omim ID
120577Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. [provided by RefSeq
Other Designations
C1q receptor 1|CD93 antigen|OTTHUMP00000030419|complement component 1, q subcomponent, receptor 1|matrix-remodelling associated 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com