CD93 monoclonal antibody (M02), clone 3D12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CD93 expression in transfected 293T cell line by CD93 monoclonal antibody (M02), clone 3D12.
Lane 1: CD93 transfected lysate (Predicted MW: 71.72 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD93 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CD93.
Immunogen
CD93 (NP_036204, 33 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (68); Rat (88)
Isotype
IgG3 Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CD93 expression in transfected 293T cell line by CD93 monoclonal antibody (M02), clone 3D12.
Lane 1: CD93 transfected lysate (Predicted MW: 71.72 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD93 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CD93
Entrez GeneID
22918GeneBank Accession#
NM_012072Protein Accession#
NP_036204Gene Name
CD93
Gene Alias
C1QR1, C1qR(P), C1qRP, CDw93, MXRA4, dJ737E23.1
Gene Description
CD93 molecule
Omim ID
120577Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. [provided by RefSeq
Other Designations
C1q receptor 1|CD93 antigen|OTTHUMP00000030419|complement component 1, q subcomponent, receptor 1|matrix-remodelling associated 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com