CARD8 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CARD8 partial ORF ( NP_055774, 322 a.a. - 431 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
WDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDPYLVSYLRQQNL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CARD8
Entrez GeneID
22900GeneBank Accession#
NM_014959Protein Accession#
NP_055774Gene Name
CARD8
Gene Alias
CARDINAL, DACAR, DKFZp779L0366, Dakar, FLJ18119, FLJ18121, KIAA0955, MGC57162, NDPP, NDPP1, TUCAN
Gene Description
caspase recruitment domain family, member 8
Omim ID
609051Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene, but their biological validity has not been determined. [provided by RefSeq
Other Designations
CARD inhibitor of NF-kappaB-activating ligands|CARD8 isoform T47|CARD8 isoform T51|CARD8 isoform T60|apoptotic protein NDPP1|tumor up-regulated CARD-containing antagonist of caspase nine
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com