Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KIAA1008 monoclonal antibody (M01), clone 2C7

  • Catalog # : H00022894-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant KIAA1008.
  • Immunogen:
  • KIAA1008 (NP_055768, 861 a.a. ~ 956 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00022894-M01
    Western Blot detection against Immunogen (36.3 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged DIS3 is 0.1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • DIS3
  • Gene Alias:
  • DKFZp667L1817,EXOSC11,FLJ10484,KIAA1008,MGC33035,RP11-342J4.3,RRP44,bA555G22.1,dis3p
  • Gene Description:
  • DIS3 mitotic control homolog (S. cerevisiae)
  • Other Designations:
  • 2810028N01Rik,DIS3 mitotic control,exosome component 11,mitotic control protein dis3 homolog
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook