VASH1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human VASH1 full-length ORF ( AAH09031.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.2
Interspecies Antigen Sequence
Mouse (86); Rat (81)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — VASH1
Entrez GeneID
22846GeneBank Accession#
BC009031.1Protein Accession#
AAH09031.1Gene Name
VASH1
Gene Alias
KIAA1036
Gene Description
vasohibin 1
Omim ID
609011Gene Ontology
HyperlinkOther Designations
-
-
Interactome
-
Publication Reference
-
Vasohibin1, a new mouse cardiomyocyte IRES trans-acting factor that regulates translation in early hypoxia.
Fransky Hantelys, Anne-Claire Godet, Florian David, Florence Tatin, Edith Renaud-Gabardos, Françoise Pujol, Leila H Diallo, Isabelle Ader, Laetitia Ligat, Anthony K Henras, Yasufumi Sato, Angelo Parini, Eric Lacazette, Barbara Garmy-Susini, Anne-Catherine Prats.
Elife 2019 Dec; 8:e50094.
Application:PI, Recombinant proteins.
-
Possible action of vasohibin-1 as an inhibitor in the regulation of vascularization of the bovine corpus luteum.
Shirasuna K, Kobayashi A, Nitta A, Nibuno S, Sasahara K, Shimizu T, Bollwein H, Miyamoto A.
Reproduction 2012 Apr; 143(4):491.
Application:Func, Bovine, Bovine luteal endothelial cells, lymphatic endothelial cells.
-
Vasohibin1, a new mouse cardiomyocyte IRES trans-acting factor that regulates translation in early hypoxia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com