Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NLGN4Y purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00022829-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NLGN4Y protein.
  • Immunogen:
  • NLGN4Y (ENSP00000297967, 1 a.a. ~ 134 a.a) full-length human protein.
  • Sequence:
  • MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NLGN4Y expression in transfected 293T cell line (H00022829-T02) by NLGN4Y MaxPab polyclonal antibody.

    Lane 1: NLGN4Y transfected lysate(15.20 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • NLGN4Y
  • Gene Alias:
  • KIAA0951
  • Gene Description:
  • neuroligin 4, Y-linked
  • Gene Summary:
  • Neuroligins, such as NLGN4Y, are cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses (Jamain et al., 2003 [PubMed 12669065]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000034787,OTTHUMP00000034789,neuroligin 4, Y linked
  • RSS
  • YouTube
  • Linkedin
  • Facebook