RASA3 monoclonal antibody (M01J), clone 1F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant RASA3.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
RASA3 (AAH47242, 725 a.a. ~ 834 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RASA3 expression in transfected 293T cell line by RASA3 monoclonal antibody (M01J), clone 1F11.
Lane 1: RASA3 transfected lysate (Predicted MW: 95.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RASA3 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — RASA3
Entrez GeneID
22821GeneBank Accession#
BC047242Protein Accession#
AAH47242Gene Name
RASA3
Gene Alias
GAP1IP4BP, GAPIII, MGC46517, MGC47588
Gene Description
RAS p21 protein activator 3
Omim ID
605182Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This family member is an inositol 1,3,4,5-tetrakisphosphate-binding protein, like the closely related RAS p21 protein activator 2. The two family members have distinct pleckstrin-homology domains, with this particular member having a domain consistent with its localization to the plasma membrane. [provided by RefSeq
Other Designations
GTPase activating protein III|Ins(1,3,4,5)P4-binding protein|inositol 1,3,4,5-tetrakisphosphate-binding protein
-
Interactomes
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com