COG2 monoclonal antibody (M09), clone 4C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of COG2 expression in transfected 293T cell line by COG2 monoclonal antibody (M09), clone 4C8.
Lane 1: COG2 transfected lysate(83.2 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of COG2 over-expressed 293 cell line, cotransfected with COG2 Validated Chimera RNAi ( Cat # H00022796-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with COG2 monoclonal antibody (M09), clone 4C8 (Cat # H00022796-M09 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant COG2.
Immunogen
COG2 (NP_031383, 639 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (80); Rat (81)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of COG2 expression in transfected 293T cell line by COG2 monoclonal antibody (M09), clone 4C8.
Lane 1: COG2 transfected lysate(83.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of COG2 over-expressed 293 cell line, cotransfected with COG2 Validated Chimera RNAi ( Cat # H00022796-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with COG2 monoclonal antibody (M09), clone 4C8 (Cat # H00022796-M09 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — COG2
Entrez GeneID
22796GeneBank Accession#
NM_007357Protein Accession#
NP_031383Gene Name
COG2
Gene Alias
LDLC
Gene Description
component of oligomeric golgi complex 2
Omim ID
606974Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi complex. The encoded protein specifically interacts with the USO1 vesicle docking protein and may be necessary for normal Golgi ribbon formation and trafficking of Golgi enzymes. Mutations of this gene are associated with abnormal glycosylation within the Golgi apparatus. Alternative splicing results in multiple transcript variants
Other Designations
OTTHUMP00000035875|brefeldin A-sensitive, peripheral Golgi protein|conserved oligomeric Golgi complex protein 2|low density lipoprotein receptor defect C complementing|transcript ch4822
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com