COG2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
COG2 polyclonal antibody (A01), Lot # 070226JCSa. Western Blot analysis of COG2 expression in PC-12.
Western Blot (Cell lysate)
COG2 polyclonal antibody (A01), Lot # 070226JCSa Western Blot analysis of COG2 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
COG2 polyclonal antibody (A01), Lot # 070226JCSa. Western Blot analysis of COG2 expression in Raw 264.7.
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant COG2.
Immunogen
COG2 (NP_031383, 639 a.a. ~ 738 a.a) partial recombinant protein with GST tag.
Sequence
LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (80); Rat (81)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
COG2 polyclonal antibody (A01), Lot # 070226JCSa. Western Blot analysis of COG2 expression in PC-12.Western Blot (Cell lysate)
COG2 polyclonal antibody (A01), Lot # 070226JCSa Western Blot analysis of COG2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
COG2 polyclonal antibody (A01), Lot # 070226JCSa. Western Blot analysis of COG2 expression in Raw 264.7.Western Blot (Recombinant protein)
ELISA
-
Gene Info — COG2
Entrez GeneID
22796GeneBank Accession#
NM_007357Protein Accession#
NP_031383Gene Name
COG2
Gene Alias
LDLC
Gene Description
component of oligomeric golgi complex 2
Omim ID
606974Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi complex. The encoded protein specifically interacts with the USO1 vesicle docking protein and may be necessary for normal Golgi ribbon formation and trafficking of Golgi enzymes. Mutations of this gene are associated with abnormal glycosylation within the Golgi apparatus. Alternative splicing results in multiple transcript variants
Other Designations
OTTHUMP00000035875|brefeldin A-sensitive, peripheral Golgi protein|conserved oligomeric Golgi complex protein 2|low density lipoprotein receptor defect C complementing|transcript ch4822
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com