U2AF2 monoclonal antibody (M03), clone 5G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
U2AF2 monoclonal antibody (M03), clone 5G8. Western Blot analysis of U2AF2 expression in HepG2.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged U2AF2 is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to U2AF2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant U2AF2.
Immunogen
U2AF2 (NP_001012496.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
U2AF2 monoclonal antibody (M03), clone 5G8. Western Blot analysis of U2AF2 expression in HepG2.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged U2AF2 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to U2AF2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — U2AF2
Entrez GeneID
11338GeneBank Accession#
NM_001012478Protein Accession#
NP_001012496.1Gene Name
U2AF2
Gene Alias
U2AF65
Gene Description
U2 small nuclear RNA auxiliary factor 2
Omim ID
191318Gene Ontology
HyperlinkGene Summary
U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date. [provided by RefSeq
Other Designations
U2 (RNU2) small nuclear RNA auxiliary factor 2|U2 small nuclear ribonucleoprotein auxiliary factor (65kD)|U2 snRNP auxiliary factor large subunit|splicing factor U2AF 65 kD subunit
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com