EXOC3 monoclonal antibody (M01), clone 4A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of EXOC3 expression in transfected 293T cell line by EXOC3 monoclonal antibody (M01), clone 4A7.
Lane 1: EXOC3 transfected lysate(86.845 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EXOC3 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EXOC3.
Immunogen
EXOC3 (NP_009208, 646 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SGFGEDVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (94)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EXOC3 expression in transfected 293T cell line by EXOC3 monoclonal antibody (M01), clone 4A7.
Lane 1: EXOC3 transfected lysate(86.845 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EXOC3 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — EXOC3
Entrez GeneID
11336GeneBank Accession#
NM_007277Protein Accession#
NP_009208Gene Name
EXOC3
Gene Alias
SEC6, SEC6L1, Sec6p
Gene Description
exocyst complex component 3
Omim ID
608186Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. [provided by RefSeq
Other Designations
SEC6-like 1|Sec 6 homolog|Sec6 protein|exocyst complex component Sec6
-
Interactome
-
Pathway
-
Publication Reference
-
West nile virus and Dengue virus capsid protein negates the antiviral activity of human Sec3 protein Through The Proteasome Pathway.
Raghavan B, Ng ML.
Cellular Microbiology 2013 Oct; 15(10):1688.
Application：IF, WB, Human, HEK 293 cells.
-
Exocyst subunits are involved in isoproterenol-induced amylase release from rat parotid acinar cells.
Imai A, Yoshie S, Haga-Tsujimura M, Nashida T, Shimomura H.
European Journal of Oral Sciences 2012 Apr; 120(2):123.
Application：IF, IP, WB-Ce, WB-Ti, Rat, Brains, Kidneys, Parotid glands, Rat parotid acinar cells.
-
West nile virus and Dengue virus capsid protein negates the antiviral activity of human Sec3 protein Through The Proteasome Pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com