CBX3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CBX3 full-length ORF ( AAH00954, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMLLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.87
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CBX3
Entrez GeneID
11335GeneBank Accession#
BC000954Protein Accession#
AAH00954Gene Name
CBX3
Gene Alias
HECH, HP1-GAMMA, HP1Hs-gamma
Gene Description
chromobox homolog 3 (HP1 gamma homolog, Drosophila)
Omim ID
604477Gene Ontology
HyperlinkGene Summary
At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene. [provided by RefSeq
Other Designations
HP1 gamma homolog|OTTHUMP00000024529|OTTHUMP00000122519|chromobox homolog 3|heterochromatin protein HP1 gamma|heterochromatin-like protein 1
-
Interactome
-
Publication Reference
-
Heterochromatin protein 1 gamma and IκB kinase alpha interdependence during tumour necrosis factor gene transcription elongation in activated macrophages.
Thorne JL, Ouboussad L, Lefevre PF.
Nucleic Acids Research 2012 Sep; 40(16):7676.
Application:ChIP, WB, Mouse, RAW264.7 cells.
-
Heterochromatin protein 1 gamma and IκB kinase alpha interdependence during tumour necrosis factor gene transcription elongation in activated macrophages.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com