Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CBX3 (Human) Recombinant Protein (P01)

  • Catalog # : H00011335-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CBX3 full-length ORF ( AAH00954, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMLLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.87
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00011335-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CBX3
  • Gene Alias:
  • HECH,HP1-GAMMA,HP1Hs-gamma
  • Gene Description:
  • chromobox homolog 3 (HP1 gamma homolog, Drosophila)
  • Gene Summary:
  • At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • HP1 gamma homolog,OTTHUMP00000024529,OTTHUMP00000122519,chromobox homolog 3,heterochromatin protein HP1 gamma,heterochromatin-like protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook