PHB2 (Human) Recombinant Protein (P02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PHB2 full-length ORF ( AAH14766, 37 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
54.67
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PHB2
Entrez GeneID
11331GeneBank Accession#
BC014766Protein Accession#
AAH14766Gene Name
PHB2
Gene Alias
BAP, BCAP37, Bap37, MGC117268, PNAS-141, REA, p22
Gene Description
prohibitin 2
Omim ID
610704Gene Ontology
HyperlinkOther Designations
B-cell associated protein|repressor of estrogen receptor activity
-
Interactome
-
Publication Reference
-
C9orf72 regulates energy homeostasis by stabilizing mitochondrial complex I assembly.
Tao Wang, Honghe Liu, Kie Itoh, Sungtaek Oh, Liang Zhao, Daisuke Murata, Hiromi Sesaki, Thomas Hartung, Chan Hyun Na, Jiou Wang.
Cell Metabolism 2021 Mar; 33(3):531.
Application:PI, WB-Re, Recombinant proteins.
-
Prohibitin binds to C3 and enhances complement activation.
Mishra S, Moulik S, Murphy LJ.
Molecular Immunology 2006 Oct; 44(8):1907.
Application:Func, Human , normal serum.
-
C9orf72 regulates energy homeostasis by stabilizing mitochondrial complex I assembly.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com