STK38 monoclonal antibody (M11), clone 2F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
STK38 monoclonal antibody (M11), clone 2F6. Western Blot analysis of STK38 expression in human kidney.
Western Blot (Cell lysate)
STK38 monoclonal antibody (M11), clone 2F6 Western Blot analysis of STK38 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human colon. [antibody concentration 2 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STK38 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to STK38 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.85 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STK38.
Immunogen
STK38 (AAH12085, 365 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
STK38 monoclonal antibody (M11), clone 2F6. Western Blot analysis of STK38 expression in human kidney.Western Blot (Cell lysate)
STK38 monoclonal antibody (M11), clone 2F6 Western Blot analysis of STK38 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human colon. [antibody concentration 2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STK38 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to STK38 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — STK38
Entrez GeneID
11329GeneBank Accession#
BC012085Protein Accession#
AAH12085Gene Name
STK38
Gene Alias
NDR, NDR1
Gene Description
serine/threonine kinase 38
Omim ID
606964Gene Ontology
HyperlinkOther Designations
Ndr Ser/Thr kinase-like protein|OTTHUMP00000016293|nuclear Dbf2-related 1|serine threonine protein kinase
-
Interactome
-
Disease
-
Publication Reference
-
Prevention of calpain-dependent degradation of STK38 by MEKK2-mediated phosphorylation.
Enomoto A, Fukasawa T, Tsumoto H, Karube M, Nakagawa K, Yoshizaki A, Sato S, Miura Y, Miyagawa K.
Scientific Reports 2019 Nov; 9(1):16010.
Application：WB-Ce, WB-Tr, Human, HeLa, LU99 cells.
-
STK38 kinase acts as XPO1 gatekeeper regulating the nuclear export of autophagy proteins and other cargoes.
Martin AP, Jacquemyn M, Lipecka J, Chhuon C, Aushev VN, Meunier B, Singh MK, Carpi N, Piel M, Codogno P, Hergovich A, Parrini MC, Zalcman G, Guerrera IC, Daelemans D, Camonis JH.
EMBO reports 2019 Nov; 20(11):e48150.
Application：WB-Tr, Human, HekRasV12, HeLa cells.
-
Serine-Threonine Kinase 38 regulates CDC25A stability and the DNA damage-induced G2/M checkpoint.
Fukasawa T, Enomoto A, Miyagawa K.
Cellular Signalling 2015 Aug; 27(8):1569.
Application：WB, Human, LU99 cells.
-
Constitutively active NDR1-PIF kinase functions independent of MST1 and hMOB1 signalling.
Cook D, Hoa LY, Gomez V, Gomez M, Hergovich A.
Cellular Signalling 2014 Aug; 26(8):1657.
Application：WB-Tr, Human, U-2 OS cells.
-
Prevention of calpain-dependent degradation of STK38 by MEKK2-mediated phosphorylation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com