STK38 monoclonal antibody (M01), clone 2G8-1F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
STK38 monoclonal antibody (M01), clone 2G8-1F3. Western Blot analysis of STK38 expression in human kidney.
Western Blot (Cell lysate)
STK38 monoclonal antibody (M01), clone 2G8-1F3 Western Blot analysis of STK38 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of STK38 expression in transfected 293T cell line by STK38 monoclonal antibody (M01), clone 2G8-1F3.
Lane 1: STK38 transfected lysate(54.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue [antibody concentration 5 ug/ml]
Immunoprecipitation
Immunoprecipitation of STK38 transfected lysate using anti-STK38 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STK38 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STK38 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to STK38 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (76.89 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant STK38.
Immunogen
STK38 (AAH12085, 1 a.a. ~ 465 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAMTGSTPCSSMSNHTKERVTMTKVTLENFSSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVAISNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (76.89 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
STK38 monoclonal antibody (M01), clone 2G8-1F3. Western Blot analysis of STK38 expression in human kidney.Western Blot (Cell lysate)
STK38 monoclonal antibody (M01), clone 2G8-1F3 Western Blot analysis of STK38 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of STK38 expression in transfected 293T cell line by STK38 monoclonal antibody (M01), clone 2G8-1F3.
Lane 1: STK38 transfected lysate(54.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue [antibody concentration 5 ug/ml]Immunoprecipitation
Immunoprecipitation of STK38 transfected lysate using anti-STK38 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STK38 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STK38 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to STK38 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — STK38
Entrez GeneID
11329GeneBank Accession#
BC012085Protein Accession#
AAH12085Gene Name
STK38
Gene Alias
NDR, NDR1
Gene Description
serine/threonine kinase 38
Omim ID
606964Gene Ontology
HyperlinkOther Designations
Ndr Ser/Thr kinase-like protein|OTTHUMP00000016293|nuclear Dbf2-related 1|serine threonine protein kinase
-
Interactome
-
Disease
-
Publication Reference
-
MICAL-1 is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis.
Zhou Y, Adolfs Y, Pijnappel WW, Fuller SJ, Van der Schors RC, Li KW, Sugden PH, Smit AB, Hergovich A, Pasterkamp RJ.
Molecular and Cellular Biology 2011 Sep; 31(17):3603.
Application：IP-WB, WB-Ce, WB-Tr, Human, Mouse, HEK293, L cells.
-
MICAL-1 is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com