COPE purified MaxPab mouse polyclonal antibody (B03P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
COPE MaxPab polyclonal antibody. Western Blot analysis of COPE expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of COPE expression in transfected 293T cell line (H00011316-T01) by COPE MaxPab polyclonal antibody.
Lane 1: COPE transfected lysate(33.88 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human COPE protein.
Immunogen
COPE (NP_009194.2, 1 a.a. ~ 308 a.a) full-length human protein.
Sequence
MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
COPE MaxPab polyclonal antibody. Western Blot analysis of COPE expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of COPE expression in transfected 293T cell line (H00011316-T01) by COPE MaxPab polyclonal antibody.
Lane 1: COPE transfected lysate(33.88 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — COPE
Entrez GeneID
11316GeneBank Accession#
NM_007263.3Protein Accession#
NP_009194.2Gene Name
COPE
Gene Alias
FLJ13241, epsilon-COP
Gene Description
coatomer protein complex, subunit epsilon
Omim ID
606942Gene Ontology
HyperlinkGene Summary
The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
coatomer epsilon subunit|epsilon coat protein|epsilon subunit of coatomer protein complex
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com