COPE polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
COPE polyclonal antibody (A01), Lot # 060116JC01 Western Blot analysis of COPE expression in HL-60 ( Cat # L014V1 ).
Western Blot detection against Immunogen (36.89 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant COPE.
Immunogen
COPE (NP_009194, 211 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Sequence
KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (92)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.89 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
COPE polyclonal antibody (A01), Lot # 060116JC01 Western Blot analysis of COPE expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — COPE
Entrez GeneID
11316GeneBank Accession#
NM_007263Protein Accession#
NP_009194Gene Name
COPE
Gene Alias
FLJ13241, epsilon-COP
Gene Description
coatomer protein complex, subunit epsilon
Omim ID
606942Gene Ontology
HyperlinkGene Summary
The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
coatomer epsilon subunit|epsilon coat protein|epsilon subunit of coatomer protein complex
-
Interactome
-
Publication Reference
-
Depletion of {beta}-COP reveals a role for COP-I in compartmentalization of secretory compartments and in biosynthetic transport of Caveolin-1.
Styers ML, O'Connor AK, Grabski R, Cormet-Boyaka E, Sztul E Phd.
American Journal of Physiology. Cell Physiology 2008 Apr; 294(6):C1485.
Application：WB, Human, HeLa cells.
-
Depletion of {beta}-COP reveals a role for COP-I in compartmentalization of secretory compartments and in biosynthetic transport of Caveolin-1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com