Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LYPLA2 polyclonal antibody (A01)

  • Catalog # : H00011313-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LYPLA2.
  • Immunogen:
  • LYPLA2 (NP_009191, 144 a.a. ~ 231 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011313-A01
    Western Blot detection against Immunogen (35.79 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • LYPLA2
  • Gene Alias:
  • APT-2,DJ886K2.4
  • Gene Description:
  • lysophospholipase II
  • Gene Summary:
  • Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000002999,OTTHUMP00000044831,acyl-protein thioesterase
  • RSS
  • YouTube
  • Linkedin
  • Facebook