Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POU6F2 polyclonal antibody (A01)

  • Catalog # : H00011281-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant POU6F2.
  • Immunogen:
  • POU6F2 (NP_009183, 2 a.a. ~ 87 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011281-A01
    Western Blot detection against Immunogen (35.57 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • POU6F2
  • Gene Alias:
  • RPF-1,WT5,WTSL
  • Gene Description:
  • POU class 6 homeobox 2
  • Gene Summary:
  • POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]).[supplied by OMIM
  • Other Designations:
  • POU domain, class 6, transcription factor 2,Wilms tumor suppressor locus,retina-derived POU-domain factor-1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook