Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCN11A (Human) Recombinant Protein (Q01)

  • Catalog # : H00011280-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SCN11A partial ORF ( NP_054858, 1726 a.a. - 1791 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00011280-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SCN11A
  • Gene Alias:
  • NAV1.9,NaN,SCN12A,SNS-2
  • Gene Description:
  • sodium channel, voltage-gated, type XI, alpha subunit
  • Gene Summary:
  • Voltage-gated sodium channels are membrane protein complexes that play a fundamental role in the rising phase of the action potential in most excitable cells. Alpha subunits, such as SCN11A, mediate voltage-dependent gating and conductance, while auxiliary beta subunits regulate the kinetic properties of the channel and facilitate membrane localization of the complex. Aberrant expression patterns or mutations of alpha subunits underlie a number of disorders. Each alpha subunit consists of 4 domains connected by 3 intracellular loops; each domain consists of 6 transmembrane segments and intra- and extracellular linkers.[supplied by OMIM
  • Other Designations:
  • sodium channel, voltage-gated, type XI, alpha,sodium channel, voltage-gated, type XI, alpha polypeptide,sodium channel, voltage-gated, type XII, alpha polypeptide,voltage-gated sodium channel Nav1.9
  • RSS
  • YouTube
  • Linkedin
  • Facebook