SCN11A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SCN11A partial ORF ( NP_054858, 1726 a.a. - 1791 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33
Interspecies Antigen Sequence
Mouse (54); Rat (56)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SCN11A
Entrez GeneID
11280GeneBank Accession#
NM_014139Protein Accession#
NP_054858Gene Name
SCN11A
Gene Alias
NAV1.9, NaN, SCN12A, SNS-2
Gene Description
sodium channel, voltage-gated, type XI, alpha subunit
Omim ID
604385Gene Ontology
HyperlinkGene Summary
Voltage-gated sodium channels are membrane protein complexes that play a fundamental role in the rising phase of the action potential in most excitable cells. Alpha subunits, such as SCN11A, mediate voltage-dependent gating and conductance, while auxiliary beta subunits regulate the kinetic properties of the channel and facilitate membrane localization of the complex. Aberrant expression patterns or mutations of alpha subunits underlie a number of disorders. Each alpha subunit consists of 4 domains connected by 3 intracellular loops; each domain consists of 6 transmembrane segments and intra- and extracellular linkers.[supplied by OMIM
Other Designations
sodium channel, voltage-gated, type XI, alpha|sodium channel, voltage-gated, type XI, alpha polypeptide|sodium channel, voltage-gated, type XII, alpha polypeptide|voltage-gated sodium channel Nav1.9
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com