SCN11A monoclonal antibody (M04), clone 6E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SCN11A.
Immunogen
SCN11A (NP_054858, 1726 a.a. ~ 1791 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (54); Rat (56)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SCN11A is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — SCN11A
Entrez GeneID
11280GeneBank Accession#
NM_014139Protein Accession#
NP_054858Gene Name
SCN11A
Gene Alias
NAV1.9, NaN, SCN12A, SNS-2
Gene Description
sodium channel, voltage-gated, type XI, alpha subunit
Omim ID
604385Gene Ontology
HyperlinkGene Summary
Voltage-gated sodium channels are membrane protein complexes that play a fundamental role in the rising phase of the action potential in most excitable cells. Alpha subunits, such as SCN11A, mediate voltage-dependent gating and conductance, while auxiliary beta subunits regulate the kinetic properties of the channel and facilitate membrane localization of the complex. Aberrant expression patterns or mutations of alpha subunits underlie a number of disorders. Each alpha subunit consists of 4 domains connected by 3 intracellular loops; each domain consists of 6 transmembrane segments and intra- and extracellular linkers.[supplied by OMIM
Other Designations
sodium channel, voltage-gated, type XI, alpha|sodium channel, voltage-gated, type XI, alpha polypeptide|sodium channel, voltage-gated, type XII, alpha polypeptide|voltage-gated sodium channel Nav1.9
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com