KLF8 monoclonal antibody (M09), clone 2E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KLF8.
Immunogen
KLF8 (NP_009181.1, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KLF8 expression in transfected 293T cell line by KLF8 monoclonal antibody (M09), clone 2E10.
Lane 1: KLF8 transfected lysate(39.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KLF8 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — KLF8
Entrez GeneID
11279GeneBank Accession#
NM_007250Protein Accession#
NP_009181.1Gene Name
KLF8
Gene Alias
BKLF3, DKFZp686O08126, DXS741, MGC138314, ZNF741
Gene Description
Kruppel-like factor 8
Omim ID
300286Gene Ontology
HyperlinkGene Summary
This gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in the regulation of epithelial to mesenchymal transition, a process which occurs normally during development but also during metastasis. A pseudogene has been identified on chromosome 16. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
zinc finger protein 741
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com