KLF12 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KLF12 partial ORF ( NP_009180, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKAR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.64
Interspecies Antigen Sequence
Mouse (97); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KLF12
Entrez GeneID
11278GeneBank Accession#
NM_007249Protein Accession#
NP_009180Gene Name
KLF12
Gene Alias
AP-2rep, AP2REP, HSPC122
Gene Description
Kruppel-like factor 12
Omim ID
607531Gene Ontology
HyperlinkGene Summary
Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
AP-2 repressor|AP-2rep transcription factor|KLF12 zinc finger transcriptional repressor|OTTHUMP00000018503|OTTHUMP00000040826
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com