KLF12 monoclonal antibody (M04), clone 3D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of KLF12 expression in transfected 293T cell line by KLF12 monoclonal antibody (M04), clone 3D2.
Lane 1: KLF12 transfected lysate(44.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KLF12.
Immunogen
KLF12 (NP_009180, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKAR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KLF12 expression in transfected 293T cell line by KLF12 monoclonal antibody (M04), clone 3D2.
Lane 1: KLF12 transfected lysate(44.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — KLF12
Entrez GeneID
11278GeneBank Accession#
NM_007249Protein Accession#
NP_009180Gene Name
KLF12
Gene Alias
AP-2rep, AP2REP, HSPC122
Gene Description
Kruppel-like factor 12
Omim ID
607531Gene Ontology
HyperlinkGene Summary
Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
AP-2 repressor|AP-2rep transcription factor|KLF12 zinc finger transcriptional repressor|OTTHUMP00000018503|OTTHUMP00000040826
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com