SP140 monoclonal antibody (M07), clone 3F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SP140.
Immunogen
SP140 (NP_009168.3, 504 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (50); Rat (54)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SP140 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SP140 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SP140 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SP140
Entrez GeneID
11262GeneBank Accession#
NM_007237Protein Accession#
NP_009168.3Gene Name
SP140
Gene Alias
LYSP100, LYSP100-A, LYSP100-B, MGC126440
Gene Description
SP140 nuclear body protein
Omim ID
608602Gene Ontology
HyperlinkOther Designations
lymphoid-specific SP100 homolog|nuclear body protein Sp140
-
Interactome
-
Disease
-
Publication Reference
-
The Epigenetic Reader Protein SP140 Regulates Dendritic Cell Activation, Maturation and Tolerogenic Potential.
Mohammed Ghiboub, Matthew Bell, Dovile Sinkeviciute, Rab K Prinjha, Menno P J de Winther, Nicola R Harker, David F Tough, Wouter J de Jonge.
Current Issues in Molecular Biology 2023 May; 45(5):4228.
Application:ChIP, Human, Human monocyte.
-
Modulation of macrophage inflammatory function through selective inhibition of the epigenetic reader protein SP140.
Mohammed Ghiboub, Jan Koster, Peter D. Craggs, Andrew Y. F. Li Yim, Anthony Shillings, Sue Hutchinson, Ryan P. Bingham, Kelly Gatfield, Ishtu L. Hageman, Gang Yao, Heather P. O’Keefe, Aaron Coffin, Amish Patel, Lisa A. Sloan, Darren J. Mitchell, Thomas G. Hayhow, Laurent Lunven, Robert J. Watson, Christopher E. Blunt, Lee A. Harrison, Gordon Bruton, Umesh Kumar, Natalie Hamer, John R. Spaull, Danny A. Zwijnenburg, Olaf Welting, Theodorus B. M. Hakvoort, Anje A. te Velde, Johan van Limbergen, Pet
BMC Biology 2022 Aug; 20(1):182.
Application:ChIP, Human, Human monocyte.
-
The Epigenetic Reader Protein SP140 Regulates Dendritic Cell Activation, Maturation and Tolerogenic Potential.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com