DCTN3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DCTN3 expression in transfected 293T cell line (H00011258-T01) by DCTN3 MaxPab polyclonal antibody.
Lane 1: DCTN3 transfected lysate(19.36 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to DCTN3 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DCTN3 protein.
Immunogen
DCTN3 (NP_077324.1, 1 a.a. ~ 176 a.a) full-length human protein.
Sequence
MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DCTN3 expression in transfected 293T cell line (H00011258-T01) by DCTN3 MaxPab polyclonal antibody.
Lane 1: DCTN3 transfected lysate(19.36 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to DCTN3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DCTN3
Entrez GeneID
11258GeneBank Accession#
NM_024348Protein Accession#
NP_077324.1Gene Name
DCTN3
Gene Alias
DCTN-22, DCTN22, MGC111190
Gene Description
dynactin 3 (p22)
Omim ID
607387Gene Ontology
HyperlinkGene Summary
This gene encodes the smallest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, cytokinesis, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like most other dynactin subunits, exists only as a part of the dynactin complex. It is primarily an alpha-helical protein with very little coiled coil, and binds directly to the largest subunit (p150) of dynactin. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000021292|OTTHUMP00000021293|OTTHUMP00000045394|dynactin 3|dynactin 3, isoform 1|dynactin light chain
-
Interactome
-
Publication Reference
-
Conformational diversity of dynactin sidearm and domain organization of its subunit p150.
Saito K, Murayama T, Hata T, Kobayashi T, Shibata K, Kazuno S, Fujimura T, Sakurai T, Toyoshima YY.
Molecular Biology of the Cell 2020 Jun; 31(12):1218.
-
Conformational diversity of dynactin sidearm and domain organization of its subunit p150.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com