PADI2 monoclonal antibody (M01), clone 4D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PADI2 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PADI2.
Immunogen
PADI2 (NP_003008, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PADI2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — PADI2
Entrez GeneID
11240GeneBank Accession#
NM_007365Protein Accession#
NP_003008Gene Name
PADI2
Gene Alias
KIAA0994, PAD-H19, PAD2, PDI2
Gene Description
peptidyl arginine deiminase, type II
Omim ID
607935Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes. [provided by RefSeq
Other Designations
OTTHUMP00000002403|OTTHUMP00000044625|peptidlyarginine deiminase type II|protein arginine deiminase|protein-arginine deiminase type-2
-
Interactome
-
Disease
-
Publication Reference
-
High titer rheumatoid arthritis antibodies preferentially bind fibrinogen citrullinated by peptidyl arginine deiminase 4.
Blachère NE, Parveen S, Frank MO, Dill BD, Molina H, Orange DE.
Arthritis & Rheumatology (Hoboken, N.J.) 2017 May; 69(5):986.
Application：WB, PAD2 citrullinated fibrinogen.
-
Inflammatory but not apoptotic death of granulocytes citrullinates fibrinogen.
Blachère NE, Parveen S, Fak J, Frank MO, Orange DE.
Arthritis Research & Therapy 2015 Dec; 17:369.
Application：WB-Ce, Human, HL60 cells.
-
High titer rheumatoid arthritis antibodies preferentially bind fibrinogen citrullinated by peptidyl arginine deiminase 4.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com