CA5B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CA5B polyclonal antibody (A01), Lot # 051213JC01 Western Blot analysis of CA5B expression in Jurkat ( Cat # L017V1 ).
Western Blot detection against Immunogen (35.9 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CA5B.
Immunogen
CA5B (NP_009151, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Sequence
VVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (88)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.9 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CA5B polyclonal antibody (A01), Lot # 051213JC01 Western Blot analysis of CA5B expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — CA5B
Entrez GeneID
11238GeneBank Accession#
NM_007220Protein Accession#
NP_009151Gene Name
CA5B
Gene Alias
CA-VB, MGC39962
Gene Description
carbonic anhydrase VB, mitochondrial
Omim ID
300230Gene Ontology
HyperlinkGene Summary
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles. [provided by RefSeq
Other Designations
carbonic dehydratase
-
Interactome
-
Pathway
-
Publication Reference
-
Carbonic anhydrases in the mouse harderian gland.
Pan PW, Waheed A, Sly WS, Parkkila S.
Journal of Molecular Histology 2010 Dec; 41(6):411.
Application：IHC-P, Mouse, Mouse harderian glands.
-
Carbonic anhydrases in the mouse harderian gland.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com