RNF139 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant RNF139.
Immunogen
RNF139 (NP_009149, 565 a.a. ~ 664 a.a) partial recombinant protein with GST tag.
Sequence
HYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — RNF139
Entrez GeneID
11236GeneBank Accession#
NM_007218Protein Accession#
NP_009149Gene Name
RNF139
Gene Alias
HRCA1, MGC31961, RCA1, TRC8
Gene Description
ring finger protein 139
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor protein VHL, as well as with COPS5/JAB1, a protein responsible for the degradation of tumor suppressor CDKN1B/P27KIP. [provided by RefSeq
Other Designations
multiple membrane spanning receptor TRC8|patched related protein translocated in renal cancer
-
Interactome
-
Publication Reference
-
The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.
Lee JP, Brauweiler A, Rudolph M, Hooper JE, Drabkin HA, Gemmill RM.
Molecular Cancer Research 2010 Jan; 8(1):93.
Application:WB-Tr, Human, HEK 293 cells.
-
The TRC8 E3 ligase ubiquitinates MHC class I molecules before dislocation from the ER.
Stagg HR, Thomas M, van den Boomen D, Wiertz EJ, Drabkin HA, Gemmill RM, Lehner PJ.
The Journal of Cell Biology 2009 Sep; 186(5):685.
Application:WB-Tr, Human, HEK 293 cells.
-
The Sterol-sensing Endoplasmic Reticulum (ER) Membrane Protein TRC8 Hampers ER to Golgi Transport of Sterol Regulatory Element-binding Protein-2 (SREBP-2)/SREBP Cleavage-activated Protein and Reduces SREBP-2 Cleavage.
Irisawa M, Inoue J, Ozawa N, Mori K, Sato R.
The Journal of Biological Chemistry 2009 Oct; 284(42):28995.
Application:WB-Tr, Human, HepG2 cells.
-
RING-dependent tumor suppression and G2/M arrest induced by the TRC8 hereditary kidney cancer gene.
Brauweiler A, Lorick KL, Lee JP, Tsai YC, Chan D, Weissman AM, Drabkin HA, Gemmill RM.
Oncogene 2006 Oct; 26(16):2263.
Application:WB, Human, RCC cells: SKRC-02, SKRC-09, SKRC-17.
-
The TRC8 ubiquitin ligase is sterol regulated and interacts with lipid and protein biosynthetic pathways.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com