SEC63 monoclonal antibody (M04), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SEC63 expression in transfected 293T cell line by SEC63 monoclonal antibody (M04), clone 1A8.
Lane 1: SEC63 transfected lysate (Predicted MW: 36.52 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEC63 is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SEC63 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SEC63.
Immunogen
SEC63 (NP_009145.1, 631 a.a. ~ 728 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KSKITHPVYSLYFPEEKQEWWWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAKPVPENHPQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SEC63 expression in transfected 293T cell line by SEC63 monoclonal antibody (M04), clone 1A8.
Lane 1: SEC63 transfected lysate (Predicted MW: 36.52 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEC63 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SEC63 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SEC63
Entrez GeneID
11231GeneBank Accession#
NM_007214Protein Accession#
NP_009145.1Gene Name
SEC63
Gene Alias
ERdj2, PRO2507, SEC63L
Gene Description
SEC63 homolog (S. cerevisiae)
Gene Ontology
HyperlinkGene Summary
The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. [provided by RefSeq
Other Designations
OTTHUMP00000016937|SEC63-like|SEC63-like protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com