GALNT6 monoclonal antibody (M01), clone 4C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GALNT6.
Immunogen
GALNT6 (NP_009141, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GALNT6 monoclonal antibody (M01), clone 4C10 Western Blot analysis of GALNT6 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GALNT6 expression in transfected 293T cell line by GALNT6 monoclonal antibody (M01), clone 4C10.
Lane 1: GALNT6 transfected lysate(71 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GALNT6 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of GALNT6 over-expressed 293 cell line, cotransfected with GALNT6 Validated Chimera RNAi ( Cat # H00011226-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GALNT6 monoclonal antibody (M01), clone 4C10 (Cat # H00011226-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — GALNT6
Entrez GeneID
11226GeneBank Accession#
NM_007210Protein Accession#
NP_009141Gene Name
GALNT6
Gene Alias
GALNAC-T6, GalNAcT6
Gene Description
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6)
Omim ID
605148Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin. [provided by RefSeq
Other Designations
GalNAc transferase 6|UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6|polypeptide N-acetylgalactosaminyltransferase 6|protein-UDP acetylgalactosaminyltransferase 6
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com