AKAP10 monoclonal antibody (M04), clone 8C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
AKAP10 monoclonal antibody (M04), clone 8C10. Western Blot analysis of AKAP10 expression in Raw 264.7.
Western Blot (Transfected lysate)
Western Blot analysis of AKAP10 expression in transfected 293T cell line by AKAP10 monoclonal antibody (M04), clone 8C10.
Lane 1: AKAP10 transfected lysate(73.8 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AKAP10 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKAP10 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of AKAP10 over-expressed 293 cell line, cotransfected with AKAP10 Validated Chimera RNAi ( Cat # H00011216-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AKAP10 monoclonal antibody (M04), clone 8C10 (Cat # H00011216-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AKAP10.
Immunogen
AKAP10 (NP_009133, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AKAP10 monoclonal antibody (M04), clone 8C10. Western Blot analysis of AKAP10 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of AKAP10 expression in transfected 293T cell line by AKAP10 monoclonal antibody (M04), clone 8C10.
Lane 1: AKAP10 transfected lysate(73.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to AKAP10 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKAP10 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of AKAP10 over-expressed 293 cell line, cotransfected with AKAP10 Validated Chimera RNAi ( Cat # H00011216-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AKAP10 monoclonal antibody (M04), clone 8C10 (Cat # H00011216-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — AKAP10
Entrez GeneID
11216GeneBank Accession#
NM_007202Protein Accession#
NP_009133Gene Name
AKAP10
Gene Alias
D-AKAP2, MGC9414, PRKA10
Gene Description
A kinase (PRKA) anchor protein 10
Gene Ontology
HyperlinkGene Summary
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction. [provided by RefSeq
Other Designations
A-kinase anchor protein 10|dual-specificity A-kinase anchoring protein 2|mitochondrial A kinase PPKA anchor protein 10|protein kinase A anchoring protein 10
-
Interactome
-
Disease
-
Publication Reference
-
Mitochondrial A-kinase anchoring proteins in cardiac ventricular myocytes.
Rinzhin T Sherpa, Chase Fiore, Karni S Moshal, Adam Wadsworth, Michael W Rudokas, Shailesh R Agarwal, Robert D Harvey.
Physiological Reports 2021 Sep; 9(17):e15015.
Application：IF, Rat, Rat ventricular myocytes.
-
D-AKAP2 interacts with Rab4 and Rab11 through its RGS domains and regulates transferrin receptor recycling.
Eggers CT, Schafer JC, Goldenring JR, Taylor SS.
The Journal of Biological Chemistry 2009 Nov; 284(47):32869.
Application：WB, IF, Human, HeLa cells.
-
Mitochondrial A-kinase anchoring proteins in cardiac ventricular myocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com