Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKAP11 polyclonal antibody (A01)

  • Catalog # : H00011215-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AKAP11.
  • Immunogen:
  • AKAP11 (NP_057332, 1801 a.a. ~ 1901 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EGLGQDGKTLLITNIDMEPCTVDPQLRIILQWLIASEAEVAELYFHDSANKEFMLLSKQLQEKGWKVGDLLQAVLQYYEVMEKASSEERCKSLFDWLLENA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011215-A01
    Western Blot detection against Immunogen (37.22 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • AKAP11
  • Gene Alias:
  • AKAP220,DKFZp781I12161,FLJ11304,KIAA0629,PRKA11
  • Gene Description:
  • A kinase (PRKA) anchor protein 11
  • Gene Summary:
  • The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is expressed at high levels throughout spermatogenesis and in mature sperm. It binds the RI and RII subunits of PKA in testis. It may serve a function in cell cycle control of both somatic cells and germ cells in addition to its putative role in spermatogenesis and sperm function. [provided by RefSeq
  • Other Designations:
  • A-kinase anchor protein 11,A-kinase anchoring protein, 220kDa,protein kinase A anchoring protein 11
  • RSS
  • YouTube
  • Linkedin
  • Facebook