AKAP13 monoclonal antibody (M01), clone 5B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKAP13 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to AKAP13 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AKAP13.
Immunogen
AKAP13 (NP_006729, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKAP13 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to AKAP13 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — AKAP13
Entrez GeneID
11214GeneBank Accession#
NM_006738Protein Accession#
NP_006729Gene Name
AKAP13
Gene Alias
AKAP-Lbc, ARHGEF13, BRX, FLJ11952, FLJ43341, HA-3, Ht31, LBC, PROTO-LB, PROTO-LBC, c-lbc
Gene Description
A kinase (PRKA) anchor protein 13
Omim ID
604686Gene Ontology
HyperlinkGene Summary
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternative splicing of this gene results in at least 3 transcript variants encoding different isoforms containing a dbl oncogene homology (DH) domain and a pleckstrin homology (PH) domain. The DH domain is associated with guanine nucleotide exchange activation for the Rho/Rac family of small GTP binding proteins, resulting in the conversion of the inactive GTPase to the active form capable of transducing signals. The PH domain has multiple functions. Therefore, these isoforms function as scaffolding proteins to coordinate a Rho signaling pathway and, in addition, function as protein kinase A-anchoring proteins. [provided by RefSeq
Other Designations
A-kinase anchor protein 13|A-kinase anchoring protein|breast cancer nuclear receptor-binding auxiliary protein|guanine nucleotide exchange factor Lbc|lymphoid blast crisis oncogene
-
Interactome
-
Disease
-
Publication Reference
-
The mRNA and protein expression of A-kinase anchor proteins 13 in human colorectal cancer.
Hu JK, Wang L, Li Y, Yang K, Zhang P, Chen XZ, Wang R, Zhou ZG.
The Journal of Clinical Endocrinology and Metabolism 2010 Mar; 10(1):41.
Application：IHC-P, Human, Adenoma tissues, Normal tissues, Solorectal carcinoma tissues.
-
The mRNA and protein expression of A-kinase anchor proteins 13 in human colorectal cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com