Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KLK8 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00011202-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human KLK8 protein.
  • Immunogen:
  • KLK8 (NP_009127.1, 1 a.a. ~ 260 a.a) full-length human protein.
  • Sequence:
  • MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • KLK8 MaxPab rabbit polyclonal antibody. Western Blot analysis of KLK8 expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of KLK8 expression in transfected 293T cell line (H00011202-T02) by KLK8 MaxPab polyclonal antibody.

    Lane 1: KLK8 transfected lysate(28.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • KLK8
  • Gene Alias:
  • HNP,NP,NRPN,PRSS19,TADG14
  • Gene Description:
  • kallikrein-related peptidase 8
  • Gene Summary:
  • Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer. [provided by RefSeq
  • Other Designations:
  • KLK8 protein type 1,KLK8 protein type 2,kallikrein 8,kallikrein 8 (neuropsin/ovasin),neuropsin type 1,neuropsin type 2,ovasin,protease, serine, 19,tumor-associated differentially expressed gene 14
  • RSS
  • YouTube
  • Linkedin
  • Facebook