Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SUPT16H (Human) Recombinant Protein (Q01)

  • Catalog # : H00011198-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SUPT16H partial ORF ( NP_009123, 608 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.62
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00011198-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SUPT16H
  • Gene Alias:
  • CDC68,FACT,FACTP140,FLJ10857,FLJ14010,FLJ34357,SPT16/CDC68
  • Gene Description:
  • suppressor of Ty 16 homolog (S. cerevisiae)
  • Gene Summary:
  • Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit; this gene encodes the 140 kDa subunit. [provided by RefSeq
  • Other Designations:
  • chromatin-specific transcription elongation factor large subunit,facilitates chromatin remodeling 140 kDa subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook