Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SUPT16H polyclonal antibody (A01)

  • Catalog # : H00011198-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SUPT16H.
  • Immunogen:
  • SUPT16H (NP_009123, 608 a.a. ~ 715 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011198-A01
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SUPT16H
  • Gene Alias:
  • CDC68,FACT,FACTP140,FLJ10857,FLJ14010,FLJ34357,SPT16/CDC68
  • Gene Description:
  • suppressor of Ty 16 homolog (S. cerevisiae)
  • Gene Summary:
  • Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit; this gene encodes the 140 kDa subunit. [provided by RefSeq
  • Other Designations:
  • chromatin-specific transcription elongation factor large subunit,facilitates chromatin remodeling 140 kDa subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook