Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CEP2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00011190-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CEP2 partial ORF ( AAH01433, 141 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00011190-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CEP250
  • Gene Alias:
  • C-NAP1,CEP2,CNAP1,MGC88542
  • Gene Description:
  • centrosomal protein 250kDa
  • Gene Summary:
  • This gene encodes a core centrosomal protein required for centriole-centriole cohesion during interphase of the cell cycle. The encoded protein dissociates from the centrosomes when parental centrioles separate at the beginning of mitosis. The protein associates with and is phosphorylated by NIMA-related kinase 2, which is also associated with the centrosome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030757,centrosomal Nek2-associated protein 1,centrosomal protein 2,centrosomal protein, 250-KD,centrosome associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook