Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

INMT polyclonal antibody (A01)

  • Catalog # : H00011185-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant INMT.
  • Immunogen:
  • INMT (NP_006765, 174 a.a. ~ 263 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKGEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011185-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • INMT
  • Gene Alias:
  • MGC125940,MGC125941
  • Gene Description:
  • indolethylamine N-methyltransferase
  • Gene Summary:
  • N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. [provided by RefSeq
  • Other Designations:
  • amine N-methyltransferase,aromatic alkylamine N-methyltransferase,arylamine N-methyltransferase,nicotine N-methyltransferase,thioester S-methyltransferase-like
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook