WDR6 monoclonal antibody (M01), clone 2D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (57.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant WDR6.
Immunogen
WDR6 (AAH02826, 1 a.a. ~ 289 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPGLGPLVAAACSDGAVRLFLLQDSGRILQLLAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWYD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (88)
Isotype
IgG2a lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — WDR6
Entrez GeneID
11180GeneBank Accession#
BC002826Protein Accession#
AAH02826Gene Name
WDR6
Gene Alias
FLJ10218, FLJ52552, FLJ56107, MGC126756, MGC142027
Gene Description
WD repeat domain 6
Omim ID
606031Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. The encoded protein interacts with serine/threonine kinase 11, and is implicated in cell growth arrest. [provided by RefSeq
Other Designations
WD repeat domain 6 protein
-
Interactome
-
Publication Reference
-
Identification and characterization of an insulin receptor substrate 4-interacting protein in rat brain: Implications for longevity.
Chiba T, Inoue D, Mizuno A, Komatsu T, Fujita S, Kubota H, Luisa Tagliaro M, Park S, Trindade LS, Hayashida T, Hayashi H, Yamaza H, Higami Y, Shimokawa I.
Neurobiology of Aging 2007 Aug; 30(3):474.
Application：IP-WB, Rat, Rat brain.
-
Identification and characterization of an insulin receptor substrate 4-interacting protein in rat brain: Implications for longevity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com